Lineage for d1uesc1 (1ues C:401-484)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (4 proteins)
  6. Protein Cambialistic superoxide dismutase [46622] (2 species)
    active with either Fe or Mn
  7. Species Porphyromonas gingivalis [TaxId:837] [46624] (3 PDB entries)
    Uniprot P19665
  8. Domain d1uesc1: 1ues C:401-484 [107802]
    Other proteins in same PDB: d1uesa2, d1uesb2, d1uesc2, d1uesd2
    complexed with mn

Details for d1uesc1

PDB Entry: 1ues (more details), 1.6 Å

PDB Description: Crystal structure of Porphyromonas gingivalis SOD
PDB Compounds: (C:) superoxide dismutase

SCOPe Domain Sequences for d1uesc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uesc1 a.2.11.1 (C:401-484) Cambialistic superoxide dismutase {Porphyromonas gingivalis [TaxId: 837]}
mthelislpyavdalapvisketvefhhgkhlktyvdnlnkliigtefenadlntivqks
eggifnnagqtlnhnlyftqfrpg

SCOPe Domain Coordinates for d1uesc1 are not available.

Timeline for d1uesc1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1uesc2
View in 3D
Domains from other chains:
(mouse over for more information)
d1uesa1, d1uesa2, d1uesb1, d1uesb2, d1uesd1, d1uesd2