Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (1 family) |
Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (3 proteins) |
Protein Cambialistic superoxide dismutase [54732] (2 species) active with either fe or mn |
Species Porphyromonas gingivalis [TaxId:837] [54734] (3 PDB entries) |
Domain d1uesb2: 1ues B:285-391 [107801] Other proteins in same PDB: d1uesa1, d1uesb1, d1uesc1, d1uesd1 |
PDB Entry: 1ues (more details), 1.6 Å
SCOP Domain Sequences for d1uesb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uesb2 d.44.1.1 (B:285-391) Cambialistic superoxide dismutase {Porphyromonas gingivalis} kggapkgklgeaidkqfgsfekfkeefntagttlfgsgwvwlasdangklsiekepnagn pvrkglnplltfdvwehayyltyqnrradhlkdlwsivdwdivesry
Timeline for d1uesb2: