Lineage for d1uesb2 (1ues B:285-391)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 602270Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 602271Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (1 family) (S)
  5. 602272Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (3 proteins)
  6. 602273Protein Cambialistic superoxide dismutase [54732] (2 species)
    active with either fe or mn
  7. 602274Species Porphyromonas gingivalis [TaxId:837] [54734] (3 PDB entries)
  8. 602280Domain d1uesb2: 1ues B:285-391 [107801]
    Other proteins in same PDB: d1uesa1, d1uesb1, d1uesc1, d1uesd1

Details for d1uesb2

PDB Entry: 1ues (more details), 1.6 Å

PDB Description: crystal structure of porphyromonas gingivalis sod

SCOP Domain Sequences for d1uesb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uesb2 d.44.1.1 (B:285-391) Cambialistic superoxide dismutase {Porphyromonas gingivalis}
kggapkgklgeaidkqfgsfekfkeefntagttlfgsgwvwlasdangklsiekepnagn
pvrkglnplltfdvwehayyltyqnrradhlkdlwsivdwdivesry

SCOP Domain Coordinates for d1uesb2:

Click to download the PDB-style file with coordinates for d1uesb2.
(The format of our PDB-style files is described here.)

Timeline for d1uesb2: