Lineage for d1uerd2 (1uer D:685-791)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins)
  6. Protein Cambialistic superoxide dismutase [54732] (2 species)
    active with either fe or mn
  7. Species Porphyromonas gingivalis [TaxId:837] [54734] (3 PDB entries)
    Uniprot P19665
  8. Domain d1uerd2: 1uer D:685-791 [107797]
    Other proteins in same PDB: d1uera1, d1uerb1, d1uerc1, d1uerd1
    complexed with fe

Details for d1uerd2

PDB Entry: 1uer (more details), 1.6 Å

PDB Description: Crystal structure of Porphyromonas gingivalis SOD
PDB Compounds: (D:) superoxide dismutase

SCOPe Domain Sequences for d1uerd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uerd2 d.44.1.1 (D:685-791) Cambialistic superoxide dismutase {Porphyromonas gingivalis [TaxId: 837]}
kggapkgklgeaidkqfgsfekfkeefntagttlfgsgwvwlasdangklsiekepnagn
pvrkglnpllgfdvwehayyltyqnrradhlkdlwsivdwdivesry

SCOPe Domain Coordinates for d1uerd2 are not available.

Timeline for d1uerd2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1uerd1
View in 3D
Domains from other chains:
(mouse over for more information)
d1uera1, d1uera2, d1uerb1, d1uerb2, d1uerc1, d1uerc2