![]() | Class a: All alpha proteins [46456] (226 folds) |
![]() | Fold a.2: Long alpha-hairpin [46556] (13 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
![]() | Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (1 family) ![]() |
![]() | Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (3 proteins) |
![]() | Protein Cambialistic superoxide dismutase [46622] (2 species) active with either Fe or Mn |
![]() | Species Porphyromonas gingivalis [TaxId:837] [46624] (3 PDB entries) |
![]() | Domain d1uerd1: 1uer D:601-684 [107796] Other proteins in same PDB: d1uera2, d1uerb2, d1uerc2, d1uerd2 complexed with fe |
PDB Entry: 1uer (more details), 1.6 Å
SCOP Domain Sequences for d1uerd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uerd1 a.2.11.1 (D:601-684) Cambialistic superoxide dismutase {Porphyromonas gingivalis} mthelislpyavdalapvisketvefhhgkhlktyvdnlnkliigtefenadlntivqks eggifnnagqtlnhnlyftqfrpg
Timeline for d1uerd1: