Lineage for d1uerd1 (1uer D:601-684)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 437311Fold a.2: Long alpha-hairpin [46556] (14 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 437446Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (1 family) (S)
  5. 437447Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (3 proteins)
  6. 437448Protein Cambialistic superoxide dismutase [46622] (2 species)
    active with either Fe or Mn
  7. 437449Species Porphyromonas gingivalis [TaxId:837] [46624] (3 PDB entries)
  8. 437453Domain d1uerd1: 1uer D:601-684 [107796]
    Other proteins in same PDB: d1uera2, d1uerb2, d1uerc2, d1uerd2

Details for d1uerd1

PDB Entry: 1uer (more details), 1.6 Å

PDB Description: Crystal structure of Porphyromonas gingivalis SOD

SCOP Domain Sequences for d1uerd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uerd1 a.2.11.1 (D:601-684) Cambialistic superoxide dismutase {Porphyromonas gingivalis}
mthelislpyavdalapvisketvefhhgkhlktyvdnlnkliigtefenadlntivqks
eggifnnagqtlnhnlyftqfrpg

SCOP Domain Coordinates for d1uerd1:

Click to download the PDB-style file with coordinates for d1uerd1.
(The format of our PDB-style files is described here.)

Timeline for d1uerd1: