Lineage for d1uerc2 (1uer C:485-591)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2552893Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 2552894Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 2552895Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins)
  6. 2552896Protein Cambialistic superoxide dismutase [54732] (2 species)
    active with either fe or mn
  7. 2552897Species Porphyromonas gingivalis [TaxId:837] [54734] (3 PDB entries)
    Uniprot P19665
  8. 2552900Domain d1uerc2: 1uer C:485-591 [107795]
    Other proteins in same PDB: d1uera1, d1uerb1, d1uerc1, d1uerd1
    complexed with fe

Details for d1uerc2

PDB Entry: 1uer (more details), 1.6 Å

PDB Description: Crystal structure of Porphyromonas gingivalis SOD
PDB Compounds: (C:) superoxide dismutase

SCOPe Domain Sequences for d1uerc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uerc2 d.44.1.1 (C:485-591) Cambialistic superoxide dismutase {Porphyromonas gingivalis [TaxId: 837]}
kggapkgklgeaidkqfgsfekfkeefntagttlfgsgwvwlasdangklsiekepnagn
pvrkglnpllgfdvwehayyltyqnrradhlkdlwsivdwdivesry

SCOPe Domain Coordinates for d1uerc2:

Click to download the PDB-style file with coordinates for d1uerc2.
(The format of our PDB-style files is described here.)

Timeline for d1uerc2: