SCOPe 2.08: Domain d1uerb2: 1uer B:285-391

Lineage for d1uerb2 (1uer B:285-391)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families)
   automatically mapped to Pfam PF02777

5. Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins)

6. Protein Cambialistic superoxide dismutase [54732] (2 species)
   active with either fe or mn

7. Species Porphyromonas gingivalis [TaxId:837] [54734] (3 PDB entries)
   Uniprot P19665

8. Domain d1uerb2: 1uer B:285-391 [107793]
   Other proteins in same PDB: d1uera1, d1uerb1, d1uerc1, d1uerd1
   complexed with fe

Details for d1uerb2

PDB Entry: 1uer, 1.6 Å

PDB Description: Crystal structure of Porphyromonas gingivalis SOD

PDB Compounds: (B:) superoxide dismutase

SCOPe Domain Sequences for d1uerb2:

Sequence; same for both SEQRES and ATOM records:

>d1uerb2 d.44.1.1 (B:285-391) Cambialistic superoxide dismutase {Porphyromonas gingivalis [TaxId: 837]}
kggapkgklgeaidkqfgsfekfkeefntagttlfgsgwvwlasdangklsiekepnagn
pvrkglnpllgfdvwehayyltyqnrradhlkdlwsivdwdivesry

Timeline for d1uerb2:

• d1uerb2 first appeared in SCOP 1.69
  
• d1uerb2 appears in SCOPe 2.07