Lineage for d1uerb2 (1uer B:285-391)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2946001Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 2946002Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 2946003Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins)
  6. 2946004Protein Cambialistic superoxide dismutase [54732] (2 species)
    active with either fe or mn
  7. 2946005Species Porphyromonas gingivalis [TaxId:837] [54734] (3 PDB entries)
    Uniprot P19665
  8. 2946007Domain d1uerb2: 1uer B:285-391 [107793]
    Other proteins in same PDB: d1uera1, d1uerb1, d1uerc1, d1uerd1
    complexed with fe

Details for d1uerb2

PDB Entry: 1uer (more details), 1.6 Å

PDB Description: Crystal structure of Porphyromonas gingivalis SOD
PDB Compounds: (B:) superoxide dismutase

SCOPe Domain Sequences for d1uerb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uerb2 d.44.1.1 (B:285-391) Cambialistic superoxide dismutase {Porphyromonas gingivalis [TaxId: 837]}
kggapkgklgeaidkqfgsfekfkeefntagttlfgsgwvwlasdangklsiekepnagn
pvrkglnpllgfdvwehayyltyqnrradhlkdlwsivdwdivesry

SCOPe Domain Coordinates for d1uerb2:

Click to download the PDB-style file with coordinates for d1uerb2.
(The format of our PDB-style files is described here.)

Timeline for d1uerb2: