Lineage for d1uera2 (1uer A:85-191)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 503030Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 503031Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (1 family) (S)
  5. 503032Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (3 proteins)
  6. 503033Protein Cambialistic superoxide dismutase [54732] (2 species)
    active with either fe or mn
  7. 503034Species Porphyromonas gingivalis [TaxId:837] [54734] (3 PDB entries)
  8. 503035Domain d1uera2: 1uer A:85-191 [107791]
    Other proteins in same PDB: d1uera1, d1uerb1, d1uerc1, d1uerd1

Details for d1uera2

PDB Entry: 1uer (more details), 1.6 Å

PDB Description: Crystal structure of Porphyromonas gingivalis SOD

SCOP Domain Sequences for d1uera2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uera2 d.44.1.1 (A:85-191) Cambialistic superoxide dismutase {Porphyromonas gingivalis}
kggapkgklgeaidkqfgsfekfkeefntagttlfgsgwvwlasdangklsiekepnagn
pvrkglnpllgfdvwehayyltyqnrradhlkdlwsivdwdivesry

SCOP Domain Coordinates for d1uera2:

Click to download the PDB-style file with coordinates for d1uera2.
(The format of our PDB-style files is described here.)

Timeline for d1uera2: