Lineage for d1uera1 (1uer A:1-84)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (4 proteins)
  6. Protein Cambialistic superoxide dismutase [46622] (2 species)
    active with either Fe or Mn
  7. Species Porphyromonas gingivalis [TaxId:837] [46624] (3 PDB entries)
    Uniprot P19665
  8. Domain d1uera1: 1uer A:1-84 [107790]
    Other proteins in same PDB: d1uera2, d1uerb2, d1uerc2, d1uerd2
    complexed with fe

Details for d1uera1

PDB Entry: 1uer (more details), 1.6 Å

PDB Description: Crystal structure of Porphyromonas gingivalis SOD
PDB Compounds: (A:) superoxide dismutase

SCOPe Domain Sequences for d1uera1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uera1 a.2.11.1 (A:1-84) Cambialistic superoxide dismutase {Porphyromonas gingivalis [TaxId: 837]}
mthelislpyavdalapvisketvefhhgkhlktyvdnlnkliigtefenadlntivqks
eggifnnagqtlnhnlyftqfrpg

SCOPe Domain Coordinates for d1uera1 are not available.

Timeline for d1uera1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1uera2
View in 3D
Domains from other chains:
(mouse over for more information)
d1uerb1, d1uerb2, d1uerc1, d1uerc2, d1uerd1, d1uerd2