SCOPe 2.06: Domain d1uefb_: 1uef B:

Lineage for d1uefb_ (1uef B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (13 proteins)
   Pfam PF00640

6. Protein Docking protein 1, Dok1 [101834] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [101835] (2 PDB entries)
   Uniprot P97465 152-254

8. Domain d1uefb_: 1uef B: [107789]
   Other proteins in same PDB: d1uefa2

Details for d1uefb_

PDB Entry: 1uef, 2.5 Å

PDB Description: Crystal Structure of Dok1 PTB Domain Complex

PDB Compounds: (B:) Docking protein 1

SCOPe Domain Sequences for d1uefb_:

Sequence; same for both SEQRES and ATOM records:

>d1uefb_ b.55.1.2 (B:) Docking protein 1, Dok1 {Mouse (Mus musculus) [TaxId: 10090]}
gsqfwvtsqkteasercglqgsyilrveaekltlltlgaqsqilepllfwpytllrrygr
dkvmfsfeagrrcpsgpgtftfqtsqgndifqaveaaiqqqka

Timeline for d1uefb_:

• d1uefb_ first appeared in SCOP 1.69
  
• d1uefb_ appears in SCOPe 2.05
  
• d1uefb_ appears in SCOPe 2.07
  
• d1uefb_ appears in the current release, SCOPe 2.08