![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.55: PH domain-like barrel [50728] (2 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
![]() | Superfamily b.55.1: PH domain-like [50729] (13 families) ![]() |
![]() | Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (12 proteins) Pfam PF00640 |
![]() | Protein Docking protein 1, Dok1 [101834] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [101835] (2 PDB entries) Uniprot P97465 152-254 |
![]() | Domain d1uefb_: 1uef B: [107789] complexed with po3 |
PDB Entry: 1uef (more details), 2.5 Å
SCOP Domain Sequences for d1uefb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uefb_ b.55.1.2 (B:) Docking protein 1, Dok1 {Mouse (Mus musculus) [TaxId: 10090]} gsqfwvtsqkteasercglqgsyilrveaekltlltlgaqsqilepllfwpytllrrygr dkvmfsfeagrrcpsgpgtftfqtsqgndifqaveaaiqqqka
Timeline for d1uefb_: