Lineage for d1uefb_ (1uef B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2803065Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2803066Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2803365Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (13 proteins)
    Pfam PF00640
  6. 2803384Protein Docking protein 1, Dok1 [101834] (1 species)
  7. 2803385Species Mouse (Mus musculus) [TaxId:10090] [101835] (2 PDB entries)
    Uniprot P97465 152-254
  8. 2803389Domain d1uefb_: 1uef B: [107789]
    Other proteins in same PDB: d1uefa2

Details for d1uefb_

PDB Entry: 1uef (more details), 2.5 Å

PDB Description: Crystal Structure of Dok1 PTB Domain Complex
PDB Compounds: (B:) Docking protein 1

SCOPe Domain Sequences for d1uefb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uefb_ b.55.1.2 (B:) Docking protein 1, Dok1 {Mouse (Mus musculus) [TaxId: 10090]}
gsqfwvtsqkteasercglqgsyilrveaekltlltlgaqsqilepllfwpytllrrygr
dkvmfsfeagrrcpsgpgtftfqtsqgndifqaveaaiqqqka

SCOPe Domain Coordinates for d1uefb_:

Click to download the PDB-style file with coordinates for d1uefb_.
(The format of our PDB-style files is described here.)

Timeline for d1uefb_: