SCOPe 2.08: Domain d1uefa1: 1uef A:5-108

Lineage for d1uefa1 (1uef A:5-108)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (13 proteins)
   Pfam PF00640

6. Protein Docking protein 1, Dok1 [101834] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [101835] (2 PDB entries)
   Uniprot P97465 152-254

8. Domain d1uefa1: 1uef A:5-108 [107788]
   Other proteins in same PDB: d1uefa2

Details for d1uefa1

PDB Entry: 1uef, 2.5 Å

PDB Description: Crystal Structure of Dok1 PTB Domain Complex

PDB Compounds: (A:) Docking protein 1

SCOPe Domain Sequences for d1uefa1:

Sequence; same for both SEQRES and ATOM records:

>d1uefa1 b.55.1.2 (A:5-108) Docking protein 1, Dok1 {Mouse (Mus musculus) [TaxId: 10090]}
gsqfwvtsqkteasercglqgsyilrveaekltlltlgaqsqilepllfwpytllrrygr
dkvmfsfeagrrcpsgpgtftfqtsqgndifqaveaaiqqqkaq

Timeline for d1uefa1:

• d1uefa1 first appeared in SCOP 1.69, called d1uefa_
  
• d1uefa1 appears in SCOPe 2.07