SCOPe 2.08: Domain d1uebb3: 1ueb B:327-384

Lineage for d1uebb3 (1ueb B:327-384)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (36 proteins)
   barrel, closed; n=5, S=8

6. Protein Elongation factor P middle and C-terminal domains [110196] (1 species)
   duplication: contains two domains of this fold

7. Species Thermus thermophilus HB8 [TaxId:300852] [110197] (1 PDB entry)
   Uniprot Q76G20

8. Domain d1uebb3: 1ueb B:327-384 [107787]
   Other proteins in same PDB: d1ueba1, d1uebb1

Details for d1uebb3

PDB Entry: 1ueb, 1.65 Å

PDB Description: Crystal structure of translation elongation factor P from Thermus thermophilus HB8

PDB Compounds: (B:) elongation factor P

SCOPe Domain Sequences for d1uebb3:

Sequence, based on SEQRES records:

>d1uebb3 b.40.4.5 (B:327-384) Elongation factor P middle and C-terminal domains {Thermus thermophilus HB8 [TaxId: 300852]}
vvelkvvdtppgvrgdtvsggskpatletgavvqvplfvepgevikvdtrtgeyvgra

Sequence, based on observed residues (ATOM records):

>d1uebb3 b.40.4.5 (B:327-384) Elongation factor P middle and C-terminal domains {Thermus thermophilus HB8 [TaxId: 300852]}
vvelkvvdtppgsggskpatletgavvqvplfvepgevikvdtrtgeyvgra

Timeline for d1uebb3:

• d1uebb3 first appeared in SCOP 1.69
  
• d1uebb3 appears in SCOPe 2.07