Class b: All beta proteins [48724] (144 folds) |
Fold b.40: OB-fold [50198] (10 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (12 families) |
Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (20 proteins) barrel, closed; n=5, S=8 |
Protein Elongation factor P middle and C-terminal domains [110196] (1 species) duplication: contains two domains of this fold |
Species Thermus thermophilus HB8 [TaxId:300852] [110197] (1 PDB entry) |
Domain d1uebb2: 1ueb B:264-326 [107786] Other proteins in same PDB: d1ueba1, d1uebb1 |
PDB Entry: 1ueb (more details), 1.65 Å
SCOP Domain Sequences for d1uebb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uebb2 b.40.4.5 (B:264-326) Elongation factor P middle and C-terminal domains {Thermus thermophilus HB8} yvetrelqylypegeemvfmdletyeqfavprsrvvgaeffkegmtalgdmyegqpikvt ppt
Timeline for d1uebb2: