| Class b: All beta proteins [48724] (178 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families) ![]() many known members contain KOW motif |
| Family b.34.5.2: eIF5a N-terminal domain-like [50110] (4 proteins) |
| Protein Elongation factor P N-terminal domain [110170] (1 species) |
| Species Thermus thermophilus HB8 [TaxId:300852] [110171] (1 PDB entry) Uniprot Q76G20 |
| Domain d1uebb1: 1ueb B:201-263 [107785] Other proteins in same PDB: d1ueba2, d1ueba3, d1uebb2, d1uebb3 |
PDB Entry: 1ueb (more details), 1.65 Å
SCOPe Domain Sequences for d1uebb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uebb1 b.34.5.2 (B:201-263) Elongation factor P N-terminal domain {Thermus thermophilus HB8 [TaxId: 300852]}
misvtdlrpgtkvkmdgglwecveyqhqklgrggakvvakfknletgatvertfnsgekl
edi
Timeline for d1uebb1: