SCOP 1.69: Domain d1uebb1: 1ueb B:201-263

Lineage for d1uebb1 (1ueb B:201-263)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.34: SH3-like barrel [50036] (15 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.5: Translation proteins SH3-like domain [50104] (4 families)
   many known members contain KOW motif

5. Family b.34.5.2: eIF5a N-terminal domain-like [50110] (3 proteins)

6. Protein Elongation factor P N-terminal domain [110170] (1 species)

7. Species Thermus thermophilus HB8 [TaxId:300852] [110171] (1 PDB entry)

8. Domain d1uebb1: 1ueb B:201-263 [107785]
   Other proteins in same PDB: d1ueba2, d1ueba3, d1uebb2, d1uebb3

Details for d1uebb1

PDB Entry: 1ueb, 1.65 Å

PDB Description: Crystal structure of translation elongation factor P from Thermus thermophilus HB8

SCOP Domain Sequences for d1uebb1:

Sequence; same for both SEQRES and ATOM records:

>d1uebb1 b.34.5.2 (B:201-263) Elongation factor P N-terminal domain {Thermus thermophilus HB8}
misvtdlrpgtkvkmdgglwecveyqhqklgrggakvvakfknletgatvertfnsgekl
edi

Timeline for d1uebb1:

• d1uebb1 is new in SCOP 1.69
  
• d1uebb1 appears in SCOP 1.71
  
• d1uebb1 appears in the current release, SCOPe 2.08