Lineage for d1uebb1 (1ueb B:201-263)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2783937Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families) (S)
    many known members contain KOW motif
  5. 2784078Family b.34.5.2: eIF5a N-terminal domain-like [50110] (4 proteins)
  6. 2784079Protein Elongation factor P N-terminal domain [110170] (1 species)
  7. 2784080Species Thermus thermophilus HB8 [TaxId:300852] [110171] (1 PDB entry)
    Uniprot Q76G20
  8. 2784082Domain d1uebb1: 1ueb B:201-263 [107785]
    Other proteins in same PDB: d1ueba2, d1ueba3, d1uebb2, d1uebb3

Details for d1uebb1

PDB Entry: 1ueb (more details), 1.65 Å

PDB Description: Crystal structure of translation elongation factor P from Thermus thermophilus HB8
PDB Compounds: (B:) elongation factor P

SCOPe Domain Sequences for d1uebb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uebb1 b.34.5.2 (B:201-263) Elongation factor P N-terminal domain {Thermus thermophilus HB8 [TaxId: 300852]}
misvtdlrpgtkvkmdgglwecveyqhqklgrggakvvakfknletgatvertfnsgekl
edi

SCOPe Domain Coordinates for d1uebb1:

Click to download the PDB-style file with coordinates for d1uebb1.
(The format of our PDB-style files is described here.)

Timeline for d1uebb1: