| Class b: All beta proteins [48724] (178 folds) |
| Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) ![]() |
| Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (32 proteins) barrel, closed; n=5, S=8 |
| Protein Elongation factor P middle and C-terminal domains [110196] (1 species) duplication: contains two domains of this fold |
| Species Thermus thermophilus HB8 [TaxId:300852] [110197] (1 PDB entry) Uniprot Q76G20 |
| Domain d1ueba3: 1ueb A:127-184 [107784] Other proteins in same PDB: d1ueba1, d1uebb1 |
PDB Entry: 1ueb (more details), 1.65 Å
SCOPe Domain Sequences for d1ueba3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ueba3 b.40.4.5 (A:127-184) Elongation factor P middle and C-terminal domains {Thermus thermophilus HB8 [TaxId: 300852]}
vvelkvvdtppgvrgdtvsggskpatletgavvqvplfvepgevikvdtrtgeyvgra
Timeline for d1ueba3: