Lineage for d1ueba3 (1ueb A:127-184)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 462779Fold b.40: OB-fold [50198] (10 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 463443Superfamily b.40.4: Nucleic acid-binding proteins [50249] (12 families) (S)
  5. 463711Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (20 proteins)
    barrel, closed; n=5, S=8
  6. 463734Protein Elongation factor P middle and C-terminal domains [110196] (1 species)
    duplication: contains two domains of this fold
  7. 463735Species Thermus thermophilus HB8 [TaxId:300852] [110197] (1 PDB entry)
  8. 463737Domain d1ueba3: 1ueb A:127-184 [107784]
    Other proteins in same PDB: d1ueba1, d1uebb1

Details for d1ueba3

PDB Entry: 1ueb (more details), 1.65 Å

PDB Description: Crystal structure of translation elongation factor P from Thermus thermophilus HB8

SCOP Domain Sequences for d1ueba3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ueba3 b.40.4.5 (A:127-184) Elongation factor P middle and C-terminal domains {Thermus thermophilus HB8}
vvelkvvdtppgvrgdtvsggskpatletgavvqvplfvepgevikvdtrtgeyvgra

SCOP Domain Coordinates for d1ueba3:

Click to download the PDB-style file with coordinates for d1ueba3.
(The format of our PDB-style files is described here.)

Timeline for d1ueba3: