Lineage for d1uddd_ (1udd D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732616Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 2732617Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 2732777Family a.132.1.3: TENA/THI-4 [101458] (9 proteins)
    Pfam PF03070; HO-related family lacking the heme-binding site
  6. 2732792Protein Hypothetical transcriptional regulator PH1161 [110028] (1 species)
  7. 2732793Species Pyrococcus horikoshii [TaxId:53953] [110029] (1 PDB entry)
    Uniprot O58873
  8. 2732797Domain d1uddd_: 1udd D: [107779]

Details for d1uddd_

PDB Entry: 1udd (more details), 2.15 Å

PDB Description: TenA homologue protein from P.horikoshii OT3
PDB Compounds: (D:) Transcriptional regulator

SCOPe Domain Sequences for d1uddd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uddd_ a.132.1.3 (D:) Hypothetical transcriptional regulator PH1161 {Pyrococcus horikoshii [TaxId: 53953]}
vmitdklrrdseqiwkkifehpfvvqlysgtlplekfkfyvlqdfnylvgltralaviss
kaeyplmaelielardevtvevenyvkllkeldltledaikteptlvnsaymdfmlatay
kgniiegltallpcfwsyaeiaeyhkdklrdnpikiyrewgkvylsneylnlvgrlrkii
dssghsgydrlrrifitgskfelafwemawrgg

SCOPe Domain Coordinates for d1uddd_:

Click to download the PDB-style file with coordinates for d1uddd_.
(The format of our PDB-style files is described here.)

Timeline for d1uddd_: