Lineage for d1uddc_ (1udd C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732616Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 2732617Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 2732777Family a.132.1.3: TENA/THI-4 [101458] (9 proteins)
    Pfam PF03070; HO-related family lacking the heme-binding site
  6. 2732792Protein Hypothetical transcriptional regulator PH1161 [110028] (1 species)
  7. 2732793Species Pyrococcus horikoshii [TaxId:53953] [110029] (1 PDB entry)
    Uniprot O58873
  8. 2732796Domain d1uddc_: 1udd C: [107778]

Details for d1uddc_

PDB Entry: 1udd (more details), 2.15 Å

PDB Description: TenA homologue protein from P.horikoshii OT3
PDB Compounds: (C:) Transcriptional regulator

SCOPe Domain Sequences for d1uddc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uddc_ a.132.1.3 (C:) Hypothetical transcriptional regulator PH1161 {Pyrococcus horikoshii [TaxId: 53953]}
mrvmitdklrrdseqiwkkifehpfvvqlysgtlplekfkfyvlqdfnylvgltralavi
sskaeyplmaelielardevtvevenyvkllkeldltledaikteptlvnsaymdfmlat
aykgniiegltallpcfwsyaeiaeyhkdklrdnpikiyrewgkvylsneylnlvgrlrk
iidssghsgydrlrrifitgskfelafwemawrgg

SCOPe Domain Coordinates for d1uddc_:

Click to download the PDB-style file with coordinates for d1uddc_.
(The format of our PDB-style files is described here.)

Timeline for d1uddc_: