![]() | Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
![]() | Fold d.131: DNA clamp [55978] (1 superfamily) contains two helices and two beta sheets duplication: fold has internal pseudo two-fold symmetry |
![]() | Superfamily d.131.1: DNA clamp [55979] (2 families) ![]() |
![]() | Family d.131.1.2: DNA polymerase processivity factor [55983] (4 proteins) duplication: consists of two domains of this fold |
![]() | Protein Proliferating cell nuclear antigen (PCNA) [55989] (5 species) |
![]() | Species Archaeon Sulfolobus tokodaii [TaxId:111955] [111175] (1 PDB entry) |
![]() | Domain d1ud9d2: 1ud9 D:127-245 [107775] complexed with zn |
PDB Entry: 1ud9 (more details), 1.68 Å
SCOP Domain Sequences for d1ud9d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ud9d2 d.131.1.2 (D:127-245) Proliferating cell nuclear antigen (PCNA) {Archaeon Sulfolobus tokodaii} efdikatinasglknaigeiaevadtllisgneekvvvkgegenkvevefskdtgsladi efnkesssaydveylndiisltklsdyvkvafadqkpmqlefnmegggkvtyllapkls
Timeline for d1ud9d2: