SCOP 1.69: Domain d1ud9d2: 1ud9 D:127-245

Lineage for d1ud9d2 (1ud9 D:127-245)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.131: DNA clamp [55978] (1 superfamily)
   contains two helices and two beta sheets
   duplication: fold has internal pseudo two-fold symmetry

4. Superfamily d.131.1: DNA clamp [55979] (2 families)

5. Family d.131.1.2: DNA polymerase processivity factor [55983] (4 proteins)
   duplication: consists of two domains of this fold

6. Protein Proliferating cell nuclear antigen (PCNA) [55989] (5 species)

7. Species Archaeon Sulfolobus tokodaii [TaxId:111955] [111175] (1 PDB entry)

8. Domain d1ud9d2: 1ud9 D:127-245 [107775]

Details for d1ud9d2

PDB Entry: 1ud9, 1.68 Å

PDB Description: Crystal Structure of Proliferating Cell Nuclear Antigen (PCNA) Homolog From Sulfolobus tokodaii

SCOP Domain Sequences for d1ud9d2:

Sequence; same for both SEQRES and ATOM records:

>d1ud9d2 d.131.1.2 (D:127-245) Proliferating cell nuclear antigen (PCNA) {Archaeon Sulfolobus tokodaii}
efdikatinasglknaigeiaevadtllisgneekvvvkgegenkvevefskdtgsladi
efnkesssaydveylndiisltklsdyvkvafadqkpmqlefnmegggkvtyllapkls

Timeline for d1ud9d2:

• d1ud9d2 is new in SCOP 1.69
  
• d1ud9d2 appears in SCOP 1.71
  
• d1ud9d2 appears in the current release, SCOPe 2.08