Lineage for d1ud9c2 (1ud9 C:127-245)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1040996Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 1040997Superfamily d.131.1: DNA clamp [55979] (2 families) (S)
  5. 1041062Family d.131.1.2: DNA polymerase processivity factor [55983] (4 proteins)
    duplication: consists of two domains of this fold
  6. 1041084Protein Proliferating cell nuclear antigen (PCNA) [55989] (5 species)
  7. 1041159Species Sulfolobus tokodaii [TaxId:111955] [111175] (1 PDB entry)
    Uniprot Q975N2
  8. 1041165Domain d1ud9c2: 1ud9 C:127-245 [107773]
    complexed with zn

Details for d1ud9c2

PDB Entry: 1ud9 (more details), 1.68 Å

PDB Description: Crystal Structure of Proliferating Cell Nuclear Antigen (PCNA) Homolog From Sulfolobus tokodaii
PDB Compounds: (C:) DNA polymerase sliding clamp A

SCOPe Domain Sequences for d1ud9c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ud9c2 d.131.1.2 (C:127-245) Proliferating cell nuclear antigen (PCNA) {Sulfolobus tokodaii [TaxId: 111955]}
efdikatinasglknaigeiaevadtllisgneekvvvkgegenkvevefskdtgsladi
efnkesssaydveylndiisltklsdyvkvafadqkpmqlefnmegggkvtyllapkls

SCOPe Domain Coordinates for d1ud9c2:

Click to download the PDB-style file with coordinates for d1ud9c2.
(The format of our PDB-style files is described here.)

Timeline for d1ud9c2: