Lineage for d1ud9b1 (1ud9 B:1-119)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2976821Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 2976822Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 2977007Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins)
    duplication: consists of two domains of this fold
  6. 2977029Protein Proliferating cell nuclear antigen (PCNA) [55989] (8 species)
  7. 2977167Species Sulfolobus tokodaii [TaxId:111955] [111175] (1 PDB entry)
    Uniprot Q975N2
  8. 2977170Domain d1ud9b1: 1ud9 B:1-119 [107770]
    complexed with zn

Details for d1ud9b1

PDB Entry: 1ud9 (more details), 1.68 Å

PDB Description: Crystal Structure of Proliferating Cell Nuclear Antigen (PCNA) Homolog From Sulfolobus tokodaii
PDB Compounds: (B:) DNA polymerase sliding clamp A

SCOPe Domain Sequences for d1ud9b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ud9b1 d.131.1.2 (B:1-119) Proliferating cell nuclear antigen (PCNA) {Sulfolobus tokodaii [TaxId: 111955]}
ahivyddvrdlkaiiqallklvdealfdikpegiqlvaidkahislikielpkemfkeyd
vpeefkfgfntqymskllkaakrkeeiiidadspevvkltlsgalnrvfnvnnievlpp

SCOPe Domain Coordinates for d1ud9b1:

Click to download the PDB-style file with coordinates for d1ud9b1.
(The format of our PDB-style files is described here.)

Timeline for d1ud9b1: