| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.131: DNA clamp [55978] (1 superfamily) contains two helices and two beta sheets duplication: fold has internal pseudo two-fold symmetry |
Superfamily d.131.1: DNA clamp [55979] (3 families) ![]() |
| Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins) duplication: consists of two domains of this fold |
| Protein Proliferating cell nuclear antigen (PCNA) [55989] (8 species) |
| Species Sulfolobus tokodaii [TaxId:111955] [111175] (1 PDB entry) Uniprot Q975N2 |
| Domain d1ud9b1: 1ud9 B:1-119 [107770] complexed with zn |
PDB Entry: 1ud9 (more details), 1.68 Å
SCOPe Domain Sequences for d1ud9b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ud9b1 d.131.1.2 (B:1-119) Proliferating cell nuclear antigen (PCNA) {Sulfolobus tokodaii [TaxId: 111955]}
ahivyddvrdlkaiiqallklvdealfdikpegiqlvaidkahislikielpkemfkeyd
vpeefkfgfntqymskllkaakrkeeiiidadspevvkltlsgalnrvfnvnnievlpp
Timeline for d1ud9b1: