![]() | Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
![]() | Fold d.124: Ribonuclease Rh-like [55894] (1 superfamily) alpha+beta fold |
![]() | Superfamily d.124.1: Ribonuclease Rh-like [55895] (1 family) ![]() |
![]() | Family d.124.1.1: Ribonuclease Rh-like [55896] (8 proteins) |
![]() | Protein Ribonuclease MC1 [55899] (1 species) |
![]() | Species Bitter gourd (Momordica charantia) [TaxId:3673] [55900] (8 PDB entries) |
![]() | Domain d1ucda_: 1ucd A: [107767] complexed with u5p, ura |
PDB Entry: 1ucd (more details), 1.3 Å
SCOP Domain Sequences for d1ucda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ucda_ d.124.1.1 (A:) Ribonuclease MC1 {Bitter gourd (Momordica charantia)} fdsfwfvqqwppavcsfqksgscpgsglrtftihglwpqqsgtsltncpgspfditkish lqsqlntlwpnvlrannqqfwshewtkhgtcsestfnqaayfklavdmrnnydiigalrp haagpngrtksrqaikgflkakfgkfpglrcrtdpqtkvsylvqvvacfaqdgstlidct rdtcganfif
Timeline for d1ucda_: