Lineage for d1uc6a_ (1uc6 A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 454980Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 454981Family b.1.2.1: Fibronectin type III [49266] (24 proteins)
  6. 454982Protein Ciliary neurotrophic factor receptor alpha [110060] (1 species)
  7. 454983Species Human (Homo sapiens) [TaxId:9606] [110061] (1 PDB entry)
  8. 454984Domain d1uc6a_: 1uc6 A: [107766]

Details for d1uc6a_

PDB Entry: 1uc6 (more details)

PDB Description: Solution Structure of the Carboxyl Terminal Domain of the Ciliary Neurotrophic Factor Receptor

SCOP Domain Sequences for d1uc6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens)}
gplgsvkpdppenvvarpvpsnprrlevtwqtpstwpdpesfplkfflryrplildqwqh
velsngtahtitdayagkeyiiqvaakdneigtwsdwsvaahatpwtee

SCOP Domain Coordinates for d1uc6a_:

Click to download the PDB-style file with coordinates for d1uc6a_.
(The format of our PDB-style files is described here.)

Timeline for d1uc6a_: