SCOPe 2.08: Domain d1uc6a1: 1uc6 A:6-109

Lineage for d1uc6a1 (1uc6 A:6-109)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein Ciliary neurotrophic factor receptor alpha [110060] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [110061] (1 PDB entry)
   Uniprot P26992 202-305

8. Domain d1uc6a1: 1uc6 A:6-109 [107766]
   Other proteins in same PDB: d1uc6a2

Details for d1uc6a1

PDB Entry: 1uc6

PDB Description: solution structure of the carboxyl terminal domain of the ciliary neurotrophic factor receptor

PDB Compounds: (A:) Ciliary Neurotrophic Factor Receptor alpha

SCOPe Domain Sequences for d1uc6a1:

Sequence; same for both SEQRES and ATOM records:

>d1uc6a1 b.1.2.1 (A:6-109) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]}
vkpdppenvvarpvpsnprrlevtwqtpstwpdpesfplkfflryrplildqwqhvelsn
gtahtitdayagkeyiiqvaakdneigtwsdwsvaahatpwtee

Timeline for d1uc6a1:

• d1uc6a1 first appeared in SCOP 1.69, called d1uc6a_
  
• d1uc6a1 appears in SCOPe 2.07