Lineage for d1uc6a1 (1uc6 A:6-109)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2358952Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2358953Family b.1.2.1: Fibronectin type III [49266] (45 protein domains)
    Pfam PF00041
  6. 2358958Protein Ciliary neurotrophic factor receptor alpha [110060] (1 species)
  7. 2358959Species Human (Homo sapiens) [TaxId:9606] [110061] (1 PDB entry)
    Uniprot P26992 202-305
  8. 2358960Domain d1uc6a1: 1uc6 A:6-109 [107766]
    Other proteins in same PDB: d1uc6a2

Details for d1uc6a1

PDB Entry: 1uc6 (more details)

PDB Description: Solution Structure of the Carboxyl Terminal Domain of the Ciliary Neurotrophic Factor Receptor
PDB Compounds: (A:) Ciliary Neurotrophic Factor Receptor alpha

SCOPe Domain Sequences for d1uc6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uc6a1 b.1.2.1 (A:6-109) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]}
vkpdppenvvarpvpsnprrlevtwqtpstwpdpesfplkfflryrplildqwqhvelsn
gtahtitdayagkeyiiqvaakdneigtwsdwsvaahatpwtee

SCOPe Domain Coordinates for d1uc6a1:

Click to download the PDB-style file with coordinates for d1uc6a1.
(The format of our PDB-style files is described here.)

Timeline for d1uc6a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1uc6a2