Lineage for d1uaxb_ (1uax B:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 488062Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 488414Superfamily c.55.3: Ribonuclease H-like [53098] (10 families) (S)
    consists of one domain of this fold
  5. 488415Family c.55.3.1: Ribonuclease H [53099] (3 proteins)
  6. 488416Protein Class II ribonuclease H (RNase HII) [53103] (4 species)
  7. 488423Species Archaeon Pyrococcus horikoshii [TaxId:53953] [110639] (1 PDB entry)
  8. 488425Domain d1uaxb_: 1uax B: [107765]

Details for d1uaxb_

PDB Entry: 1uax (more details), 2 Å

PDB Description: Crystal structure of the ribonuclease H2 from Pyrococcus horikoshii OT3

SCOP Domain Sequences for d1uaxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uaxb_ c.55.3.1 (B:) Class II ribonuclease H (RNase HII) {Archaeon Pyrococcus horikoshii}
mkvagvdeagrgpvigplvigvavideknierlrdigvkdskqltpgqreklfsklidil
ddyyvllvtpkeiderhhsmneleaekfvvalnslrikpqkiyvdsadvdpkrfaslika
glkyeatviaehkadakyeivsaasiiakvtrdreieklkqkygefgsgypsdprtkewl
eeyykqygdfppivrrtwetarkieerfrkn

SCOP Domain Coordinates for d1uaxb_:

Click to download the PDB-style file with coordinates for d1uaxb_.
(The format of our PDB-style files is described here.)

Timeline for d1uaxb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1uaxa_