SCOP 1.69: Domain d1uaxb_: 1uax B:

Lineage for d1uaxb_ (1uax B:)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (10 families)
   consists of one domain of this fold

5. Family c.55.3.1: Ribonuclease H [53099] (3 proteins)

6. Protein Class II ribonuclease H (RNase HII) [53103] (4 species)

7. Species Archaeon Pyrococcus horikoshii [TaxId:53953] [110639] (1 PDB entry)

8. Domain d1uaxb_: 1uax B: [107765]

Details for d1uaxb_

PDB Entry: 1uax, 2 Å

PDB Description: Crystal structure of the ribonuclease H2 from Pyrococcus horikoshii OT3

SCOP Domain Sequences for d1uaxb_:

Sequence; same for both SEQRES and ATOM records:

>d1uaxb_ c.55.3.1 (B:) Class II ribonuclease H (RNase HII) {Archaeon Pyrococcus horikoshii}
mkvagvdeagrgpvigplvigvavideknierlrdigvkdskqltpgqreklfsklidil
ddyyvllvtpkeiderhhsmneleaekfvvalnslrikpqkiyvdsadvdpkrfaslika
glkyeatviaehkadakyeivsaasiiakvtrdreieklkqkygefgsgypsdprtkewl
eeyykqygdfppivrrtwetarkieerfrkn

Timeline for d1uaxb_:

• d1uaxb_ is new in SCOP 1.69
  
• d1uaxb_ appears in SCOP 1.71
  
• d1uaxb_ appears in the current release, SCOPe 2.08