![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.3: Ribonuclease H-like [53098] (12 families) ![]() consists of one domain of this fold |
![]() | Family c.55.3.1: Ribonuclease H [53099] (4 proteins) |
![]() | Protein Class II ribonuclease H (RNase HII) [53103] (5 species) |
![]() | Species Archaeon Pyrococcus horikoshii [TaxId:53953] [110639] (2 PDB entries) |
![]() | Domain d1uaxa_: 1uax A: [107764] |
PDB Entry: 1uax (more details), 2 Å
SCOP Domain Sequences for d1uaxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uaxa_ c.55.3.1 (A:) Class II ribonuclease H (RNase HII) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} mkvagvdeagrgpvigplvigvavideknierlrdigvkdskqltpgqreklfsklidil ddyyvllvtpkeiderhhsmneleaekfvvalnslrikpqkiyvdsadvdpkrfaslika glkyeatviaehkadakyeivsaasiiakvtrdreieklkqkygefgsgypsdprtkewl eeyykqygdfppivrrtwetarkieerfrkn
Timeline for d1uaxa_: