Lineage for d1ua7a2 (1ua7 A:4-347)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2829819Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 2829944Protein Bacterial alpha-amylase [51447] (10 species)
  7. 2829971Species Bacillus subtilis [TaxId:1423] [51450] (2 PDB entries)
    Uniprot P00691
  8. 2829972Domain d1ua7a2: 1ua7 A:4-347 [107760]
    Other proteins in same PDB: d1ua7a1
    complexed with aci, ca

Details for d1ua7a2

PDB Entry: 1ua7 (more details), 2.21 Å

PDB Description: crystal structure analysis of alpha-amylase from bacillus subtilis complexed with acarbose
PDB Compounds: (A:) alpha-amylase

SCOPe Domain Sequences for d1ua7a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ua7a2 c.1.8.1 (A:4-347) Bacterial alpha-amylase {Bacillus subtilis [TaxId: 1423]}
psiksgtilhawnwsfntlkhnmkdihdagytaiqtspinqvkegnqgdksmsnwywlyq
ptsyqignrylgteqefkemcaaaeeygikvivdavinhttfdyaaisnevksipnwthg
ntqiknwsdrwdvtqnsllglydwntqntqvqsylkrfleralndgadgfrfdaakhiel
pddgsygsqfwpnitntsaefqygeilqdsasrdaayanymdvtasnyghsirsalknrn
lgvsnishyasdvsadklvtwveshdtyanddeestwmsdddirlgwaviasrsgstplf
fsrpegggngvrfpgksqigdrgsalfedqaitavnrfhnvmag

SCOPe Domain Coordinates for d1ua7a2:

Click to download the PDB-style file with coordinates for d1ua7a2.
(The format of our PDB-style files is described here.)

Timeline for d1ua7a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ua7a1