Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (22 families) |
Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins) |
Protein Class alpha GST [81360] (8 species) |
Species Schistosoma japonicum [TaxId:6182] [52878] (9 PDB entries) |
Domain d1ua5a2: 1ua5 A:1-80 [107758] Other proteins in same PDB: d1ua5a1 complexed with gtt, sul |
PDB Entry: 1ua5 (more details), 2.5 Å
SCOP Domain Sequences for d1ua5a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ua5a2 c.47.1.5 (A:1-80) Class alpha GST {Schistosoma japonicum [TaxId: 6182]} spilgywkikglvqptrllleyleekyeehlyerdegdkwrnkkfelglefpnlpyyidg dvkltqsmaiiryiadkhnm
Timeline for d1ua5a2: