Lineage for d1ua5a1 (1ua5 A:81-215)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1998814Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1998815Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1998816Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 1998829Protein Class alpha GST [81349] (8 species)
  7. 1998962Species Schistosoma japonicum [TaxId:6182] [47633] (14 PDB entries)
    Uniprot P08515
  8. 1998968Domain d1ua5a1: 1ua5 A:81-215 [107757]
    Other proteins in same PDB: d1ua5a2
    complexed with gsh, so4

Details for d1ua5a1

PDB Entry: 1ua5 (more details), 2.5 Å

PDB Description: non-fusion gst from s. japonicum in complex with glutathione
PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d1ua5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ua5a1 a.45.1.1 (A:81-215) Class alpha GST {Schistosoma japonicum [TaxId: 6182]}
lggcpkeraeismlegavldirygvsriayskdfetlkvdflsklpemlkmfedrlchkt
ylngdhvthpdfmlydaldvvlymdpmcldafpklvcfkkrieaipqidkylksskyiaw
plqgwqatfgggdhp

SCOPe Domain Coordinates for d1ua5a1:

Click to download the PDB-style file with coordinates for d1ua5a1.
(The format of our PDB-style files is described here.)

Timeline for d1ua5a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ua5a2