| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
| Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins) |
| Protein Class alpha GST [81349] (8 species) |
| Species Schistosoma japonicum [TaxId:6182] [47633] (12 PDB entries) Uniprot P08515 |
| Domain d1ua5a1: 1ua5 A:81-215 [107757] Other proteins in same PDB: d1ua5a2 complexed with gsh, so4 |
PDB Entry: 1ua5 (more details), 2.5 Å
SCOPe Domain Sequences for d1ua5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ua5a1 a.45.1.1 (A:81-215) Class alpha GST {Schistosoma japonicum [TaxId: 6182]}
lggcpkeraeismlegavldirygvsriayskdfetlkvdflsklpemlkmfedrlchkt
ylngdhvthpdfmlydaldvvlymdpmcldafpklvcfkkrieaipqidkylksskyiaw
plqgwqatfgggdhp
Timeline for d1ua5a1: