Class a: All alpha proteins [46456] (284 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins) |
Protein Class alpha GST [81349] (8 species) |
Species Schistosoma japonicum [TaxId:6182] [47633] (12 PDB entries) Uniprot P08515 |
Domain d1ua5a1: 1ua5 A:81-215 [107757] Other proteins in same PDB: d1ua5a2 complexed with gtt, sul |
PDB Entry: 1ua5 (more details), 2.5 Å
SCOP Domain Sequences for d1ua5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ua5a1 a.45.1.1 (A:81-215) Class alpha GST {Schistosoma japonicum [TaxId: 6182]} lggcpkeraeismlegavldirygvsriayskdfetlkvdflsklpemlkmfedrlchkt ylngdhvthpdfmlydaldvvlymdpmcldafpklvcfkkrieaipqidkylksskyiaw plqgwqatfgggdhp
Timeline for d1ua5a1: