Lineage for d1ua5a1 (1ua5 A:81-215)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 538429Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 538430Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 538431Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (16 proteins)
  6. 538442Protein Class alpha GST [81349] (8 species)
  7. 538515Species Schistosoma japonicum [TaxId:6182] [47633] (9 PDB entries)
  8. 538520Domain d1ua5a1: 1ua5 A:81-215 [107757]
    Other proteins in same PDB: d1ua5a2
    complexed with gtt, sul

Details for d1ua5a1

PDB Entry: 1ua5 (more details), 2.5 Å

PDB Description: non-fusion gst from s. japonicum in complex with glutathione

SCOP Domain Sequences for d1ua5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ua5a1 a.45.1.1 (A:81-215) Class alpha GST {Schistosoma japonicum}
lggcpkeraeismlegavldirygvsriayskdfetlkvdflsklpemlkmfedrlchkt
ylngdhvthpdfmlydaldvvlymdpmcldafpklvcfkkrieaipqidkylksskyiaw
plqgwqatfgggdhp

SCOP Domain Coordinates for d1ua5a1:

Click to download the PDB-style file with coordinates for d1ua5a1.
(The format of our PDB-style files is described here.)

Timeline for d1ua5a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ua5a2