Lineage for d1ua0a2 (1ua0 A:469-876)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3016464Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 3016465Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 3016466Family e.8.1.1: DNA polymerase I [56673] (5 proteins)
    in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
  6. 3016467Protein DNA polymerase I (Klenow fragment) [56674] (3 species)
  7. 3016468Species Bacillus stearothermophilus, newly identified strain as yet unnamed [TaxId:1422] [56677] (44 PDB entries)
    Uniprot Q5KWC1 299-878 # 99% sequence identity; Geobacillus kaustophilus TaxID:1462
    Uniprot Q45458 298-876 # 88% sequence identity
  8. 3016512Domain d1ua0a2: 1ua0 A:469-876 [107754]
    Other proteins in same PDB: d1ua0a1
    protein/DNA complex; complexed with af, so4

Details for d1ua0a2

PDB Entry: 1ua0 (more details), 2.1 Å

PDB Description: aminofluorene dna adduct at the pre-insertion site of a dna polymerase
PDB Compounds: (A:) DNA polymerase I

SCOPe Domain Sequences for d1ua0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ua0a2 e.8.1.1 (A:469-876) DNA polymerase I (Klenow fragment) {Bacillus stearothermophilus, newly identified strain as yet unnamed [TaxId: 1422]}
eqdrllveleqplssilaemefagvkvdtkrleqmgkelaeqlgtveqriyelagqefni
nspkqlgvilfeklqlpvlkktktgystsadvleklapyheivenilhyrqlgklqstyi
egllkvvrpdtkkvhtifnqaltqtgrlsstepnlqnipirleegrkirqafvpsesdwl
ifaadysqielrvlahiaeddnlmeafrrdldihtktamdifqvsedevtpnmrrqakav
nfgivygisdyglaqnlnisrkeaaefieryfesfpgvkrymenivqeakqkgyvttllh
rrrylpditsrnfnvrsfaermamntpiqgsaadiikkamidlnarlkeerlqahlllqv
hdelileapkeemerlcrlvpevmeqavtlrvplkvdyhygstwydak

SCOPe Domain Coordinates for d1ua0a2:

Click to download the PDB-style file with coordinates for d1ua0a2.
(The format of our PDB-style files is described here.)

Timeline for d1ua0a2: