SCOPe 2.07: Domain d1u9lb_: 1u9l B:

Lineage for d1u9lb_ (1u9l B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.4: Rad51 N-terminal domain-like [47794] (4 families)
   contains one classic and one pseudo HhH motifs

5. Family a.60.4.2: NusA extra C-terminal domains [109873] (2 proteins)

6. Protein Transcription elongation protein NusA [109874] (1 species)

7. Species Escherichia coli [TaxId:562] [109875] (1 PDB entry)
   Uniprot P03003 352-419

8. Domain d1u9lb_: 1u9l B: [107752]
   complexed with au

Details for d1u9lb_

PDB Entry: 1u9l, 1.9 Å

PDB Description: Structural basis for a NusA- protein N interaction

PDB Compounds: (B:) Transcription elongation protein nusA

SCOPe Domain Sequences for d1u9lb_:

Sequence; same for both SEQRES and ATOM records:

>d1u9lb_ a.60.4.2 (B:) Transcription elongation protein NusA {Escherichia coli [TaxId: 562]}
ahaaidtftkyldidedfatvlveegfstleelayvpmkelleiegldeptvealrerak
nalatiaqaq

Timeline for d1u9lb_:

• d1u9lb_ first appeared in SCOP 1.69
  
• d1u9lb_ appears in SCOPe 2.06
  
• d1u9lb_ appears in the current release, SCOPe 2.08