SCOP 1.71: Domain d1u9la_: 1u9l A:

Lineage for d1u9la_ (1u9l A:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.60: SAM domain-like [47768] (14 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.4: Rad51 N-terminal domain-like [47794] (3 families)
   contains one classic and one pseudo HhH motifs

5. Family a.60.4.2: NusA extra C-terminal domains [109873] (1 protein)

6. Protein Transcription elongation protein NusA [109874] (1 species)

7. Species Escherichia coli [TaxId:562] [109875] (1 PDB entry)

8. Domain d1u9la_: 1u9l A: [107751]

Details for d1u9la_

PDB Entry: 1u9l, 1.9 Å

PDB Description: Structural basis for a NusA- protein N interaction

SCOP Domain Sequences for d1u9la_:

Sequence; same for both SEQRES and ATOM records:

>d1u9la_ a.60.4.2 (A:) Transcription elongation protein NusA {Escherichia coli}
ahaaidtftkyldidedfatvlveegfstleelayvpmkelleiegldeptvealrerak
nalatiaq

Timeline for d1u9la_:

• d1u9la_ first appeared in SCOP 1.69
  
• d1u9la_ appears in SCOP 1.73
  
• d1u9la_ appears in the current release, SCOPe 2.08