SCOPe 2.05: Domain d1u9da_: 1u9d A:

Lineage for d1u9da_ (1u9d A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
   (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
   generally forms trimers with three closely packed beta-sheets

4. Superfamily d.80.1: Tautomerase/MIF [55331] (7 families)

5. Family d.80.1.5: VC0714-like [111043] (1 protein)
   automatically mapped to Pfam PF08921

6. Protein Hypothetical protein VC0714 [111044] (1 species)

7. Species Vibrio cholerae [TaxId:666] [111045] (1 PDB entry)
   Uniprot Q9KU16

8. Domain d1u9da_: 1u9d A: [107749]
   complexed with po4

Details for d1u9da_

PDB Entry: 1u9d, 1.7 Å

PDB Description: Structure of Protein of Unknown Function from Vibrio cholerae O1 biovar eltor str. N16961

PDB Compounds: (A:) hypothetical protein VC0714

SCOPe Domain Sequences for d1u9da_:

Sequence; same for both SEQRES and ATOM records:

>d1u9da_ d.80.1.5 (A:) Hypothetical protein VC0714 {Vibrio cholerae [TaxId: 666]}
gvdlgtenlyfssnamphlrfraveahiveslvptllnelssllstarnaftfelintqy
faeggvypmvevlwfgreqqtqdqiaqvitdqirqllgadshlavvfiplqrtayyldgq
hf

Timeline for d1u9da_:

• d1u9da_ first appeared in SCOP 1.69
  
• d1u9da_ appears in SCOPe 2.04
  
• d1u9da_ is called d1u9da1 in SCOPe 2.06
  
• d1u9da_ appears in the current release, SCOPe 2.08, called d1u9da1