![]() | Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
![]() | Fold d.80: Tautomerase/MIF [55330] (1 superfamily) (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet generally forms trimers with three closely packed beta-sheets |
![]() | Superfamily d.80.1: Tautomerase/MIF [55331] (5 families) ![]() |
![]() | Family d.80.1.5: VC0714-like [111043] (1 protein) |
![]() | Protein Hypothetical protein VC0714 [111044] (1 species) |
![]() | Species Vibrio cholerae [TaxId:666] [111045] (1 PDB entry) |
![]() | Domain d1u9da_: 1u9d A: [107749] |
PDB Entry: 1u9d (more details), 1.7 Å
SCOP Domain Sequences for d1u9da_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u9da_ d.80.1.5 (A:) Hypothetical protein VC0714 {Vibrio cholerae} gvdlgtenlyfssnamphlrfraveahiveslvptllnelssllstarnaftfelintqy faeggvypmvevlwfgreqqtqdqiaqvitdqirqllgadshlavvfiplqrtayyldgq hf
Timeline for d1u9da_: