Lineage for d1u99a2 (1u99 A:269-328)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 602508Fold d.48: Anti-LPS factor/recA domain [54751] (2 superfamilies)
    alpha-beta(3)-alpha(2); 2 layers, alpha/beta
  4. 602509Superfamily d.48.1: RecA protein, C-terminal domain [54752] (1 family) (S)
  5. 602510Family d.48.1.1: RecA protein, C-terminal domain [54753] (1 protein)
  6. 602511Protein RecA protein, C-terminal domain [54754] (4 species)
  7. 602514Species Escherichia coli [TaxId:562] [54755] (8 PDB entries)
  8. 602520Domain d1u99a2: 1u99 A:269-328 [107748]
    Other proteins in same PDB: d1u99a1
    complexed with po4

Details for d1u99a2

PDB Entry: 1u99 (more details), 2.6 Å

PDB Description: crystal structures of e. coli reca in a compressed helical filament form 4

SCOP Domain Sequences for d1u99a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u99a2 d.48.1.1 (A:269-328) RecA protein, C-terminal domain {Escherichia coli}
nfygelvdlgvkekliekagawysykgekigqgkanatawlkdnpetakeiekkvrelll

SCOP Domain Coordinates for d1u99a2:

Click to download the PDB-style file with coordinates for d1u99a2.
(The format of our PDB-style files is described here.)

Timeline for d1u99a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1u99a1