Lineage for d1u8xx2 (1u8x X:170-445)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1680346Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 1680347Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 1680789Family d.162.1.2: AglA-like glucosidase [90050] (5 proteins)
    family 4 glycosyl hydrolase
    automatically mapped to Pfam PF11975
  6. 1680822Protein Maltose-6'-phosphate glucosidase GlvA [103329] (1 species)
  7. 1680823Species Bacillus subtilis [TaxId:1423] [103330] (1 PDB entry)
    Uniprot P54716
  8. 1680824Domain d1u8xx2: 1u8x X:170-445 [107742]
    Other proteins in same PDB: d1u8xx1
    complexed with g6p, mn, nad

Details for d1u8xx2

PDB Entry: 1u8x (more details), 2.05 Å

PDB Description: crystal structure of glva from bacillus subtilis, a metal-requiring, nad-dependent 6-phospho-alpha-glucosidase
PDB Compounds: (X:) Maltose-6'-phosphate glucosidase

SCOPe Domain Sequences for d1u8xx2:

Sequence, based on SEQRES records: (download)

>d1u8xx2 d.162.1.2 (X:170-445) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]}
icdmpvgiedrmaqilglssrkemkvryyglnhfgwwtsiqdqegndlmpklkehvsqyg
yipkteaeaveaswndtfakardvqaadpdtlpntylqyylfpddmvkksnpnhtranev
megreafifsqcdmitreqssenseikiddhasyivdlaraiayntgermllivenngai
anfdptamvevpcivgsngpepitvgtipqfqkglmeqqvsvekltveawaeksfqklwq
alilsktvpnarvarliledlveankdfwpeldqsp

Sequence, based on observed residues (ATOM records): (download)

>d1u8xx2 d.162.1.2 (X:170-445) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]}
icdmpvgiedrmaqilglssrkemkvryyglnhfgwwtsiqdqegndlmpklkehvsqyg
yipktswndtfakardvqaadpdtlpntylqyylfpddmvkksnpnhtranevmegreaf
ifsqcdmitreqssenseikiddhasyivdlaraiayntgermllivenngaianfdpta
mvevpcivgsngpepitvgtipqfqkglmeqqvsvekltveawaeksfqklwqalilskt
vpnarvarliledlveankdfwpeldqsp

SCOPe Domain Coordinates for d1u8xx2:

Click to download the PDB-style file with coordinates for d1u8xx2.
(The format of our PDB-style files is described here.)

Timeline for d1u8xx2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1u8xx1