![]() | Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) ![]() |
![]() | Family c.2.1.5: LDH N-terminal domain-like [51848] (8 proteins) |
![]() | Protein Maltose-6'-phosphate glucosidase GlvA [102169] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [102170] (1 PDB entry) |
![]() | Domain d1u8xx1: 1u8x X:3-169 [107741] Other proteins in same PDB: d1u8xx2 |
PDB Entry: 1u8x (more details), 2.05 Å
SCOP Domain Sequences for d1u8xx1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u8xx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis} kksfsiviagggstftpgivlmlldhleefpirklklydndkerqdriagacdvfireka pdiefaattdpeeaftdvdfvmahirvgkyamraldeqiplkygvvgqetcgpggiaygm rsiggvleildymekyspdawmlnysnpaaivaeatrrlrpnskiln
Timeline for d1u8xx1: