Lineage for d1u8xx1 (1u8x X:3-169)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 476939Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 476940Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 478258Family c.2.1.5: LDH N-terminal domain-like [51848] (8 proteins)
  6. 478445Protein Maltose-6'-phosphate glucosidase GlvA [102169] (1 species)
  7. 478446Species Bacillus subtilis [TaxId:1423] [102170] (1 PDB entry)
  8. 478447Domain d1u8xx1: 1u8x X:3-169 [107741]
    Other proteins in same PDB: d1u8xx2

Details for d1u8xx1

PDB Entry: 1u8x (more details), 2.05 Å

PDB Description: crystal structure of glva from bacillus subtilis, a metal-requiring, nad-dependent 6-phospho-alpha-glucosidase

SCOP Domain Sequences for d1u8xx1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u8xx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis}
kksfsiviagggstftpgivlmlldhleefpirklklydndkerqdriagacdvfireka
pdiefaattdpeeaftdvdfvmahirvgkyamraldeqiplkygvvgqetcgpggiaygm
rsiggvleildymekyspdawmlnysnpaaivaeatrrlrpnskiln

SCOP Domain Coordinates for d1u8xx1:

Click to download the PDB-style file with coordinates for d1u8xx1.
(The format of our PDB-style files is described here.)

Timeline for d1u8xx1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1u8xx2