Lineage for d1u8sb2 (1u8s B:88-180)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 503917Fold d.58: Ferredoxin-like [54861] (49 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 505075Superfamily d.58.18: ACT-like [55021] (5 families) (S)
    regulatory domain linked to a wide range of metabolic enzymes
  5. 505102Family d.58.18.5: Glycine cleavage system transcriptional repressor [110980] (1 protein)
    tandem repeat of two ACT-like domains; swapped domain dimer
  6. 505103Protein putative transcriptional repressor VC2159 [110981] (1 species)
  7. 505104Species Vibrio cholerae [TaxId:666] [110982] (1 PDB entry)
  8. 505108Domain d1u8sb2: 1u8s B:88-180 [107740]
    Structural genomics target

Details for d1u8sb2

PDB Entry: 1u8s (more details), 2.45 Å

PDB Description: Crystal structure of putative glycine cleavage system transcriptional repressor

SCOP Domain Sequences for d1u8sb2:

Sequence, based on SEQRES records: (download)

>d1u8sb2 d.58.18.5 (B:88-180) putative transcriptional repressor VC2159 {Vibrio cholerae}
qthaytvevyvesddklgltekftqffaqrqigmaslsaqtiskdklhseqnqfhiaisa
rvdsgcnlmqlqeefdalctaldvqgslnfikn

Sequence, based on observed residues (ATOM records): (download)

>d1u8sb2 d.58.18.5 (B:88-180) putative transcriptional repressor VC2159 {Vibrio cholerae}
qthaytvevyvesddklgltekftqffaqrqigmaslsaqtisknqfhiaisarvdsgcn
lmqlqeefdalctaldvqgslnfikn

SCOP Domain Coordinates for d1u8sb2:

Click to download the PDB-style file with coordinates for d1u8sb2.
(The format of our PDB-style files is described here.)

Timeline for d1u8sb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1u8sb1