Lineage for d1u8sb2 (1u8s B:88-180)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2954059Superfamily d.58.18: ACT-like [55021] (15 families) (S)
    regulatory domain linked to a wide range of metabolic enzymes
  5. 2954150Family d.58.18.5: Glycine cleavage system transcriptional repressor [110980] (1 protein)
    tandem repeat of two ACT-like domains; swapped domain dimer
  6. 2954151Protein putative transcriptional repressor VC2159 [110981] (1 species)
  7. 2954152Species Vibrio cholerae [TaxId:666] [110982] (1 PDB entry)
    Uniprot Q9KQ45
  8. 2954156Domain d1u8sb2: 1u8s B:88-180 [107740]
    Other proteins in same PDB: d1u8sa3, d1u8sb3
    Structural genomics target

Details for d1u8sb2

PDB Entry: 1u8s (more details), 2.45 Å

PDB Description: Crystal structure of putative glycine cleavage system transcriptional repressor
PDB Compounds: (B:) glycine cleavage system transcriptional repressor, putative

SCOPe Domain Sequences for d1u8sb2:

Sequence, based on SEQRES records: (download)

>d1u8sb2 d.58.18.5 (B:88-180) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]}
qthaytvevyvesddklgltekftqffaqrqigmaslsaqtiskdklhseqnqfhiaisa
rvdsgcnlmqlqeefdalctaldvqgslnfikn

Sequence, based on observed residues (ATOM records): (download)

>d1u8sb2 d.58.18.5 (B:88-180) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]}
qthaytvevyvesddklgltekftqffaqrqigmaslsaqtisknqfhiaisarvdsgcn
lmqlqeefdalctaldvqgslnfikn

SCOPe Domain Coordinates for d1u8sb2:

Click to download the PDB-style file with coordinates for d1u8sb2.
(The format of our PDB-style files is described here.)

Timeline for d1u8sb2: