SCOP 1.71: Domain d1u8sa1: 1u8s A:2-87

Lineage for d1u8sa1 (1u8s A:2-87)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.18: ACT-like [55021] (5 families)
   regulatory domain linked to a wide range of metabolic enzymes

5. Family d.58.18.5: Glycine cleavage system transcriptional repressor [110980] (1 protein)
   tandem repeat of two ACT-like domains; swapped domain dimer

6. Protein putative transcriptional repressor VC2159 [110981] (1 species)

7. Species Vibrio cholerae [TaxId:666] [110982] (1 PDB entry)

8. Domain d1u8sa1: 1u8s A:2-87 [107737]

Details for d1u8sa1

PDB Entry: 1u8s, 2.45 Å

PDB Description: Crystal structure of putative glycine cleavage system transcriptional repressor

SCOP Domain Sequences for d1u8sa1:

Sequence; same for both SEQRES and ATOM records:

>d1u8sa1 d.58.18.5 (A:2-87) putative transcriptional repressor VC2159 {Vibrio cholerae}
sltqhlvitavgtdrpgicnevvrlvtqagcniidsriamfgkeftllmlisgspsnitr
vettlpllgqqhdlitmmkrtsphdh

Timeline for d1u8sa1:

• d1u8sa1 first appeared in SCOP 1.69
  
• d1u8sa1 appears in SCOP 1.73
  
• d1u8sa1 appears in the current release, SCOPe 2.08