Lineage for d1u8eb1 (1u8e B:39-508)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 469290Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
    consists of eight 4-stranded beta-sheet motifs; meander
    also found in some members of the WD40-repeat superfamily
  4. 469366Superfamily b.70.3: Dipeptidyl peptidase IV/CD26, N-terminal domain [82171] (1 family) (S)
  5. 469367Family b.70.3.1: Dipeptidyl peptidase IV/CD26, N-terminal domain [82172] (1 protein)
  6. 469368Protein Dipeptidyl peptidase IV/CD26, N-terminal domain [82173] (2 species)
  7. 469369Species Human (Homo sapiens) [TaxId:9606] [82174] (10 PDB entries)
  8. 469381Domain d1u8eb1: 1u8e B:39-508 [107735]
    Other proteins in same PDB: d1u8ea2, d1u8eb2

Details for d1u8eb1

PDB Entry: 1u8e (more details), 2.2 Å

PDB Description: human dipeptidyl peptidase iv/cd26 mutant y547f

SCOP Domain Sequences for d1u8eb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u8eb1 b.70.3.1 (B:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Human (Homo sapiens)}
srktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfdef
ghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtws
pvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwsp
ngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslss
vtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwn
clvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfit
kgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyys
vsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvq

SCOP Domain Coordinates for d1u8eb1:

Click to download the PDB-style file with coordinates for d1u8eb1.
(The format of our PDB-style files is described here.)

Timeline for d1u8eb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1u8eb2