| Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
| Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (32 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
| Family c.69.1.24: Dipeptidyl peptidase IV/CD26, C-terminal domain [82497] (1 protein) N-terminal domain is a 8-bladed beta-propeller |
| Protein Dipeptidyl peptidase IV/CD26, C-terminal domain [82498] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [82499] (10 PDB entries) |
| Domain d1u8ea2: 1u8e A:509-764 [107734] Other proteins in same PDB: d1u8ea1, d1u8eb1 |
PDB Entry: 1u8e (more details), 2.2 Å
SCOP Domain Sequences for d1u8ea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u8ea2 c.69.1.24 (A:509-764) Dipeptidyl peptidase IV/CD26, C-terminal domain {Human (Homo sapiens)}
mpskkldfiilnetkfwyqmilpphfdkskkypllldvfagpcsqkadtvfrlnwatyla
steniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwg
wsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstv
msraenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstah
qhiythmshfikqcfs
Timeline for d1u8ea2: